Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 8 - Jul 13
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Cholera Toxin B subunit （CTB)Product Specification Synonyms CHOLERA TOXIN B SUBUNITCTB Cholera Toxin B subunitCTxBCholeragenoid Accession P01556 Amino Acid Sequence MTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN Expression System E. coli Molecular Weight 11. 8kDa(Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <0. 2EU g Conjugation Unconjugated Physical Appearance Lyophilized Powder Storage Buffer 20mM Tris, 100mM
Product Specification
| Synonyms | CHOLERA TOXIN B SUBUNIT、CTB、 Cholera Toxin B subunit、CTxB、Choleragenoid |
| Accession | P01556 |
| Amino Acid Sequence | MTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN |
| Expression System | E.coli |
| Molecular Weight | 11.8kDa(Reducing) |
| Purity | ＞95% by SDS-PAGE & RP-HPLC |
| Endotoxin | <0.2EU/μg |
| Conjugation | Unconjugated |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris, 100mM NaCl, pH9.0 |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation . |
| Stability & Storage | · 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
Cholera toxin （CTB）belongs to the AB5 –subunit family oftoxins.The native hexameric protein has a molecular mass of ~85 kDa and contains two subunits. It consists of a single A subunit (~27.2 kDa), responsible for the ADP-ribosylation activity, and five B subunits(~11.6 kDa each), which are arranged as a pentameric ring with an apparent 5-fold symmetry and are associated with the cell surface receptor binding and subsequent internalization (transmembrane transport)of the enzymatic component.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy